Protein Info for Echvi_3768 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: H+/gluconate symporter and related permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 334 to 344 (11 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details amino acids 414 to 436 (23 residues), see Phobius details PF02447: GntP_permease" amino acids 4 to 435 (432 residues), 293.1 bits, see alignment E=3.4e-91

Best Hits

KEGG orthology group: None (inferred from 74% identity to fbc:FB2170_02050)

Predicted SEED Role

"D-glycerate transporter (predicted)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G579 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Echvi_3768 H+/gluconate symporter and related permeases (Echinicola vietnamensis KMM 6221, DSM 17526)
MTYLIALILSLAVLIMGIIKFKVHPFFMLLLAALTYGLAAGMSGQQMIAAINIGFGEILG
KIGLIILFGVTIGTILEKSGGALVMANRILSLIGKKSIHLAMMVTGYVLSIPVFADSALM
MMNPLNKMLSKKAGVSFAGTTAALAMGLTASHVMVPPTPGPIAAAGILEANLGDVIVWGL
LISCVALVPCYGYAKKVADKLIVPVSVEVVASPAAQPPLWKSLLAILIPLLLILIKSVLE
YPTINPGDSILVQVLLFLGTPVMALLVGVILSLMLPKKLDEAVFSSSGWIGESLKVAAPI
ILITGAGGIFGKMLQESGLAEAVTAGFEGAKWGLFVPFLLAACLKTTQGSSTVALVTTAS
ICAPLMPFLGLDEGFMRTMTVLAIGAGSSVASHVNDSFFWVLTQLTGMNVKQGYQVQTAG
TFVFGCSAMIVIYVITKILA