Protein Info for Echvi_3758 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted ATPases of PP-loop superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR00290: MJ0570-related uncharacterized domain" amino acids 3 to 199 (197 residues), 130.7 bits, see alignment E=3.2e-42 PF01902: Diphthami_syn_2_N" amino acids 3 to 121 (119 residues), 47.8 bits, see alignment E=1.4e-16 PF28410: Diphthami_syn_2_C" amino acids 130 to 201 (72 residues), 56.5 bits, see alignment E=2.6e-19

Best Hits

KEGG orthology group: K06927, (no description) (inferred from 56% identity to fps:FP1009)

Predicted SEED Role

"conserved hypothetical protein [Pyrococcus horikoshii]; COG2102: Predicted ATPases of PP-loop superfamily; IPR002761: Domain of unknown function DUF71"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G569 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Echvi_3758 Predicted ATPases of PP-loop superfamily (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKSVFNWSGGKDSALALHHVLKDDSITVDSLLTTINGHHQRISMHGVRRELLHAQAKSI
GIPLDELLLPEMPSMDTYNLLMGEKMDAFKRAGITESIFGDIFLEDLKQYREEKLAQKGL
KARFPLWKRDTSELIREFLDLGFKTVVVCIKDTVVPEEFLGRVIDLDFIKDLPSAIDPCG
ENGEFHTFVFDGPIFTSAIPFTFGEKVLRRYEAPKDQKDSCYSDTQEQPKAVGFHFQDLK
LDQ