Protein Info for Echvi_3757 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF02283: CobU" amino acids 4 to 168 (165 residues), 172 bits, see alignment E=4.3e-55

Best Hits

KEGG orthology group: K02231, adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC: 2.7.1.156 2.7.7.62] (inferred from 57% identity to fps:FP1461)

Predicted SEED Role

"Adenosylcobinamide-phosphate guanylyltransferase (EC 2.7.7.62)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.7.7.62)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.156 or 2.7.7.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G183 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Echvi_3757 Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MIHYITGGERSGKSRYAQQLAESLTRAPIYLATSRIWDQDFQQRVDRHQADRDERWTTME
VEKHIGQVDVAQKVVVMDCVTLWLTNWYGDAKGDITSCLKDCKAELAQLFASAQQGTLIV
ISNEIGMGLHAQTETGRKFTELQGWINQYIAQRADKAVFMVSGLPLNLK