Protein Info for Echvi_3747 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted oxidoreductases (related to aryl-alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 63% identical to GPR_ECO57: L-glyceraldehyde 3-phosphate reductase (gpr) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 75% identity to phe:Phep_2077)

MetaCyc: 63% identical to L-glyceraldehyde 3-phosphate reductase (Escherichia coli K-12 substr. MG1655)
Aldehyde reductase. [EC: 1.1.1.21]; 1.1.1.- [EC: 1.1.1.21]

Predicted SEED Role

"Putative ion-channel protein"

MetaCyc Pathways

methylglyoxal degradation III (1/2 steps found)
superpathway of methylglyoxal degradation (5/8 steps found)
D-arabinose degradation V (1/3 steps found)
detoxification of reactive carbonyls in chloroplasts (2/10 steps found)
superpathway of pentose and pentitol degradation (11/42 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G172 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Echvi_3747 Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) (Echinicola vietnamensis KMM 6221, DSM 17526)
MDYQPSKNRYDHMTYRRCGKSGLKLPALSLGLWHNFGHVDVLENSRKILQAAFDAGITHF
DLANNYGPPPGSAEENFGKILQSDFQGYRDQLVISTKAGYYMWEGPYGEWGSKKYLVSSL
DQSLQRMKLDYVDIFYHHRPDPDTPLEETMAALDLIVRQGKALYVGISNYQAEDAAKAIG
ILKELGTPCLIHQPKYSMFERWVEGGLLDVLGDEGVGCIPFSPLAQGLLTDKYLKGIPED
SRAAKSHGFLQKSAITEDTLSKINQLNELARSRGQSLAQMALSWLLKDVRITSVLIGVSK
TSQLEDSLKCLDNCSFSDEELANIEQILK