Protein Info for Echvi_3741 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 366 (330 residues), 274.3 bits, see alignment E=5.9e-86 PF25917: BSH_RND" amino acids 62 to 199 (138 residues), 70.7 bits, see alignment E=3.1e-23 PF25876: HH_MFP_RND" amino acids 102 to 171 (70 residues), 37.6 bits, see alignment E=8.5e-13 PF25944: Beta-barrel_RND" amino acids 207 to 289 (83 residues), 48.6 bits, see alignment E=3.5e-16 PF25954: Beta-barrel_RND_2" amino acids 235 to 290 (56 residues), 26.7 bits, see alignment 2.1e-09 PF25967: RND-MFP_C" amino acids 298 to 357 (60 residues), 43 bits, see alignment E=1.4e-14 PF25989: YknX_C" amino acids 298 to 366 (69 residues), 48.8 bits, see alignment E=2e-16

Best Hits

KEGG orthology group: K03585, membrane fusion protein (inferred from 47% identity to dfe:Dfer_0041)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3R8 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Echvi_3741 RND family efflux transporter, MFP subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKFLWIIFVVGVAGVVSSCGSEANTQAGQGQQVISVHATSVTSKHVTGLDLYPGTVVPL
NEIEIRPQVSGYINKIFVEDGQEVAKGQKLYEIDRSKYQAAYEQAQATLKSAKANLERVK
KDLARYEALDKQEAIAKQQLDYAKADILTAESQVSSAEAQVRSTLTDYNYSVITAPFSGT
VGISQVRLGAQVSAGQSLLNTLSSNDPVLVDFVVNERDVRRFSKMMKNESLPDSTFTIQF
GENDVYRHHGELTTIDRAVGRQSGTINMRVEFPNPDRELIPGMTLNLRVLNQDIGDQIAI
PFKAVTEQMGEYFVYVVGDDSVVHQQNVQLGTKVGAEIVVREGLKPGQKIVVEGIQKLRE
GAKVQIDA