Protein Info for Echvi_3728 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 3-carboxymuconate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF10282: Lactonase" amino acids 41 to 386 (346 residues), 350.5 bits, see alignment E=5.5e-109

Best Hits

KEGG orthology group: K07404, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 41% identity to bph:Bphy_2090)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.31

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G536 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Echvi_3728 3-carboxymuconate cyclase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKSAFYLLMLVAMSTLFACNSSEKQATSESSTDSLASPITFWLGTYTSKPSDGFHLIQYH
PETSTFDSVLMESDINNPSFVISNLKRDLVFTVQEEGGENGGSVCSFRFDRSANSLKKLS
TSASQGSGPCYITLSPDEKFIFAGNYGSGDLAVLPINEDGTLGEAVQTIQHTGSSVNEGR
QSSPHVHSLVFHPNGKQLFVADLGTDKVSIYNYDPDRKEPLTASSPASFTVKAGSGPRHL
AFNQSGDKIYLIHEITSEVGLYDYNLDENKITHLDSYALTPQGFEGEKGAAEIKISDDGQ
FLYASNRGDSNEIIVFSINAQTGTLDKIQAISSGGKTPRNFALSPDGTFLFVGNQNSDSI
LAYERNPRSGIIKKTNAKLPIHRPVYFFMLGE