Protein Info for Echvi_3724 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details PF12823: DUF3817" amino acids 10 to 97 (88 residues), 107.8 bits, see alignment E=1.9e-35 TIGR03954: integral membrane protein" amino acids 13 to 96 (84 residues), 111.2 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 46% identical to YDZA_BACSU: Uncharacterized membrane protein YdzA (ydzA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 52% identity to phe:Phep_3170)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4J8 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Echvi_3724 integral membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MNTEHQLKILNRFRIISYAEGISYLLLLFVAMPLKYTMDMPLAVKYTGWVHGILFIVYVY
LVFPTRRSLNWSFRRTLFALIASVLPFGPFLFDRKLRQQEHQLEDQS