Protein Info for Echvi_3718 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF01218: Coprogen_oxidas" amino acids 10 to 299 (290 residues), 417 bits, see alignment E=1.4e-129

Best Hits

Swiss-Prot: 50% identical to HEM6_GLOVI: Oxygen-dependent coproporphyrinogen-III oxidase (hemF) from Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)

KEGG orthology group: K00228, coproporphyrinogen III oxidase [EC: 1.3.3.3] (inferred from 64% identity to sli:Slin_2294)

Predicted SEED Role

"Coproporphyrinogen III oxidase, aerobic (EC 1.3.3.3)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G525 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Echvi_3718 Coproporphyrinogen III oxidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MPNNISKEQISEAFKTIQDHICQALETADGKAKFHEDLWEREAGGGGRTRIIKDGNVIAK
GGVAFSAVHGPTPEKILKKLQLEKADFYATGVSIVIHPSSPMVPIIHMNIRYFEMSDGTY
WFGGGIDLTPHYVDKADARYFHEQVKATCDQYNPAFYPKFKKWADDYFYLPHRNETRGVG
GIFFDRLTASAENSFESIFEFVKAIGYLFPEVYGHFMQKNAPLHFGKNEQKWQALRRGRY
VEFNLVWDAGTKFGLDTNGRTESILMSMPPVAEWAYMNIPEEGSKEAETLEWLKKDIDWI
NV