Protein Info for Echvi_3710 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: conserved hypothetical integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 40 to 246 (207 residues), 138.1 bits, see alignment E=1.7e-44 PF02592: Vut_1" amino acids 65 to 239 (175 residues), 157 bits, see alignment E=2.4e-50

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 71% identity to sli:Slin_0995)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G311 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Echvi_3710 conserved hypothetical integral membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSTTADHTFQHKKTTLFIVLSGIFLTNAILAELIGVKIFSGEATLGLEPANWTFFGDYVL
DFNLTAGAVIWPVVFITTDIINEYFGKKGVRKISFLTAGFIAYAFVFIAIVTALPPAQFW
LDVNSTDPNGQPFDIEYAFDVIFRQGLGIIIGSLTAFLLGQLIDVFVFQKLRKITGAKMI
WLRATGSTLVSQLIDSFVVLGIAFYVFGNWSIEQLIAVGIINYIYKFTVAIILTPLLYLG
HNLIDRYLGKEYAERMAEEAAEDTSF