Protein Info for Echvi_3708 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: anti-anti-sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 TIGR00377: anti-anti-sigma factor" amino acids 2 to 105 (104 residues), 56.1 bits, see alignment E=1.5e-19 PF01740: STAS" amino acids 5 to 107 (103 residues), 53.2 bits, see alignment E=2.3e-18 PF13466: STAS_2" amino acids 21 to 92 (72 residues), 33.8 bits, see alignment E=3.1e-12

Best Hits

KEGG orthology group: None (inferred from 54% identity to mtt:Ftrac_1527)

Predicted SEED Role

"anti-sigma F factor antagonist (spoIIAA-2); anti sigma b factor antagonist RsbV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G515 at UniProt or InterPro

Protein Sequence (127 amino acids)

>Echvi_3708 anti-anti-sigma factor (Echinicola vietnamensis KMM 6221, DSM 17526)
MKYAVDKKEQYVIFTLQEEKLDSPLSPVLKSELLTVHAEGYKNLVLDMSQVKYADSSGLS
ALLVGHRAFSEDGGIFIIASPQEHVTKLIKISMLDKVMNVADSIENAADQIFMHEIDGNK
EEEEEEN