Protein Info for Echvi_3698 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Putative hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF19576: Acyltransf_2" amino acids 21 to 277 (257 residues), 228.6 bits, see alignment E=6.5e-72 PF01553: Acyltransferase" amino acids 77 to 204 (128 residues), 38 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 62% identity to lby:Lbys_2965)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G503 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Echvi_3698 Putative hemolysin (Echinicola vietnamensis KMM 6221, DSM 17526)
MDKNDWSLEESKKKFIEIKEVIRDKNPKLLKWIPGFVLNYIRKITHEDEVNRLMADYGHL
HGMEFVNALILDFGVQIDLKGAENIPQTAPVIFVSNHPLGGFDGIAFMHAIGKYRQDIRF
LVNDILTNVKNFDPLFVPVNKHGSHGRKAARLIEETYAGENAVLVFPAGLVSRKQAHGIS
DLEWKKSFITKAKKYKKDIVPVYIDGRNSSFFYNLAKFRKKIGVKANIEMMYLADEMFGQ
KNKKVTIHVGKPISYQYFDDTKSEKDWAAEVKSIVYSMASES