Protein Info for Echvi_3692 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF01370: Epimerase" amino acids 3 to 82 (80 residues), 32.8 bits, see alignment E=1.2e-11 PF07993: NAD_binding_4" amino acids 5 to 47 (43 residues), 21.3 bits, see alignment 3.5e-08 PF13460: NAD_binding_10" amino acids 7 to 144 (138 residues), 37.2 bits, see alignment E=7.2e-13 PF11066: DUF2867" amino acids 331 to 465 (135 residues), 116.3 bits, see alignment E=3.6e-37

Best Hits

KEGG orthology group: None (inferred from 63% identity to ppn:Palpr_0308)

Predicted SEED Role

"Putative nucleoside-diphosphate-sugar epimerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G117 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Echvi_3692 Predicted nucleoside-diphosphate-sugar epimerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKILLTGATGYIGKRLLPSLVRMGHEVVCCVRDKNRFEPPPSLRKNIQVVEVDFLKESSL
SHIPKDIQAAYYLIHSMSSADDFSEMEKKSAQNFRKSLQGSEVKHVLYLGGIINNEMLSK
HLQSRKVVEEELAKGHYHFTALRAGIIIGSGSASFEIIRDLVEKLPVMIAPRWLKTRCQP
IAIRDVISFLSLSLGEPKAHDRAFDIGGPDILSYKEMLLGYAKNRGLARSIWTVPVMTPR
LSSYWLFFVTSTSYKLAVALVDSMKVEVICQPNHLAETLGIKPMNYQQALSAAFTKIESN
EVISSWKDSLISGRFENNLSEYIQIPTHGCFVDSRSVPVSHESDTLDRIFAIGGDTGWYY
GNWLWKLRGFMDKLAGGVGLRRGRTHPTTINSGDAVDFWRVLYAKKAEKRLLLYAEMKVP
GDAWLEFKIENGCLVQTATFRPKGLWGRVYWYAVYPFHGPIFGGMVRKLAG