Protein Info for Echvi_3679 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Acetyltransferase (isoleucine patch superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF12464: Mac" amino acids 3 to 47 (45 residues), 31.9 bits, see alignment 2e-11 PF14602: Hexapep_2" amino acids 124 to 159 (36 residues), 40.9 bits, see alignment 2.1e-14 PF00132: Hexapep" amino acids 125 to 159 (35 residues), 42 bits, see alignment 7.1e-15

Best Hits

Swiss-Prot: 47% identical to YJV8_YEAST: Putative acetyltransferase YJL218W (YJL218W) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00661, maltose O-acetyltransferase [EC: 2.3.1.79] (inferred from 83% identity to ttu:TERTU_2172)

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.79

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3J9 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Echvi_3679 Acetyltransferase (isoleucine patch superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKMMAGEPYDAHCEDMIRIRTRVKRILHKLNVTEYYTDKFQATINELCPNSAKDLHLEP
PFHCDYGQNIHAGEGVFINFDAVILDGAKVTIGRKTLLAPGVHIYTARHPLNVEERREWE
DCRPVTIGEECWIGGHVTICPGVTIGDRAVIGAGAVVTKDIPADSLAVGNPAKVIKTLNE
KDHKTTYKT