Protein Info for Echvi_3667 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transposase and inactivated derivatives

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF13007: LZ_Tnp_IS66" amino acids 47 to 121 (75 residues), 48.1 bits, see alignment E=2.4e-16 PF13005: zf-IS66" amino acids 132 to 161 (30 residues), 31.7 bits, see alignment (E = 2.6e-11) PF03050: DDE_Tnp_IS66" amino acids 183 to 465 (283 residues), 297 bits, see alignment E=2.3e-92

Best Hits

KEGG orthology group: None (inferred from 56% identity to shg:Sph21_4930)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>Echvi_3667 Transposase and inactivated derivatives (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKPLDQLTKAELLALLQKSEQQVADRERVIAEKERILAEKEAYEKQLLAMIEKFKRMSF
AQKRERFLGNKDQMALPFEPDQEQEQQQQEGFSRKVEYIRKKRPAHTGRQPLPDHLPVEE
IEIHPEGDLSGMECIGKEVTEELDYIPAQYIRRRYIRYKYAPKDRYSSAGVKIGLLPERA
IPKGIPGYGLLTDILTRKYLEHMPLYRQAQRFKREKIPIAPTTLEGWVKQGLEKLEPLYD
CLVDDTKAMGYLMVDESTIRVLDSDNKKGACHTGYYWVYHNPLENTVLFDYRPTRSKEGP
SAILENFQGYLQSDGYGVYEHYVANKQVTHLACWAHARRKFFETLVENKKAASEALGFIG
KLYDVERKAKKENLSAEDRKKLRLDEALPVINKMSEWIKKQLPKALPKSGLRKALFYSAN
RWAELSNYLYDGKLEIDNNPVEREIRSMVVGRKNYLFAGSHKAAQRAAMIYSFFGICKLH
DVNPQQWLEHALRNIMTTNHKNIRDLYPQNFNQTTRG