Protein Info for Echvi_3653 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type sulfate/molybdate transport systems, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 130 bits, see alignment E=9.7e-42

Best Hits

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 52% identity to din:Selin_1851)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3H0 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Echvi_3653 ABC-type sulfate/molybdate transport systems, ATPase component (Echinicola vietnamensis KMM 6221, DSM 17526)
MINIDLQKSLKANGPAMDLDIKLTISQGEFITLFGPSGSGKTSTLRMISGLLTPDKGHLS
VNGEQWFDASFGKNVSPGRRKLGYLFQDYSLFPNMTVKENIAFALKNAKDKAYLMELLES
MGLLHLQDTLPKHLSGGQQQRVALARALALKPDILLLDEPLSALDPSMREKLQEYILAIH
RKYALTTILVSHDAGEIIKLSDRIIELDHGKVLRQCTPKEFFGTGLTSAKFQFQGEIMDI
LEDDVVHIVHVKTGNDLVKVVCDMDETKELGVGDKVLVGSKAFNPLIKKL