Protein Info for Echvi_3631 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Sugar kinases, ribokinase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 3 to 302 (300 residues), 100.4 bits, E=6.5e-33

Best Hits

KEGG orthology group: K00874, 2-dehydro-3-deoxygluconokinase [EC: 2.7.1.45] (inferred from 50% identity to dfe:Dfer_4125)

Predicted SEED Role

"2-dehydro-3-deoxygluconate kinase (EC 2.7.1.45)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.45)

MetaCyc Pathways

• superpathway of hexuronide and hexuronate degradation (9/10 steps found)
• D-galacturonate degradation I (5/5 steps found)
• D-fructuronate degradation (4/4 steps found)
• superpathway of β-D-glucuronosides degradation (6/7 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• alginate degradation (1/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (14/31 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.45

Sequence Analysis Tools

See L0G4A1 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Echvi_3631 Sugar kinases, ribokinase family (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKRVITLGEIMMRLSTPGHERFVSSNQYNIVYGGAEANVAISLANWGISTAHVTAFPNN
DIGKAALQYLRYAGLDTQYVYFEEGRMGLYFVENGAMQRSSKIIYDRFDSVFANFDGDKI
DWKAVFKGADWFHWTGITPAISASAAKICTEAVNAASELGVKISGDINYRRNLWQYGKQP
LDIMPDLIAKTNVVIAGLTDFENCMDIHEQDYEAACKKAQEKCPSIEYISTTHRNSISAS
HNGLSGVLWNGHELLESKSYDMTHIVDRVGGGDAYMAGLIYGLLEGEDQAALEYAVAASV
LKHSIPGDANFVTVDEVSQLVKGENVGKLLR