Protein Info for Echvi_3609 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferases, probably involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 346 to 363 (18 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 64 to 111 (48 residues), 38.6 bits, see alignment 2.2e-13 amino acids 140 to 202 (63 residues), 35.5 bits, see alignment E=1.9e-12 PF13641: Glyco_tranf_2_3" amino acids 147 to 332 (186 residues), 58 bits, see alignment E=2.5e-19 PF13632: Glyco_trans_2_3" amino acids 237 to 401 (165 residues), 47.3 bits, see alignment E=4.6e-16

Best Hits

KEGG orthology group: None (inferred from 51% identity to fjo:Fjoh_3921)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4R3 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Echvi_3609 Glycosyltransferases, probably involved in cell wall biogenesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MYSLLFDILIDLFGIFFLLYGFAVIVIYMTITTLSGLELREQFKKNKFVDYKDVITTPMA
PGVSILAPAYNEGKSLVQNVRSLLSLHFSKYEVIIINDGSKDNSIEVLVENFDLKKTDFA
FEKTIDTQPIKAVYKSENPSFSKLIVIDKVNGGKADALNAGINVANQELIACIDVDCILA
PDSIIRMLRPFLEETHKKVIAVGGGIGIANNCDIKDGTVVKYRVPRTLLGRFQVIEYFRS
FLLGRMAWSRVNGLLLISGAFGFFDKELVKKVGGYFPPTVGEDMELVVRMRRYMEEQKLP
YKVAFISDPLCWTEVPETEEVLSKQRNRWMRGTIETLQLHRKMQFNWNYGFTGMVSFPFW
TIFEKNAPIIEFLGVIYTFILIFLGEFSAVYFISLFVLIYFFSVMLSSFSILFEELFFKK
YGRKGELRKLIVTVLKEPFFVHPKLMFWCLKGHWNFIKGIGGWGEMVRAGFKNTKESRQN