Protein Info for Echvi_3602 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: methionine-S-sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 18 to 167 (150 residues), 183.4 bits, see alignment E=1.8e-58 PF01625: PMSR" amino acids 18 to 185 (168 residues), 230.5 bits, see alignment E=6.6e-73

Best Hits

Swiss-Prot: 51% identical to MSRA_POLAQ: Peptide methionine sulfoxide reductase MsrA (msrA) from Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 58% identity to rmr:Rmar_2736)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3C4 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Echvi_3602 methionine-S-sulfoxide reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTLPKTPLKAIPEGKQVATFGSGCFWCIEAVYQNLRGVEGIMPGYAGGFVEEPSYEAIS
RGTTGHAEVIQFFYDPHIISFQDLLEVFWATHDPTTVNQQGNDIGPQYRSAIFYHSEEQR
NLAEEFKQLIEKAGVYDKPIVTEITEFSNFYPAEHYHVNYYENHPNQAYCQLMIKPKLEK
LKKVFGQHTKLI