Protein Info for Echvi_3582 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tetratricopeptide repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF07719: TPR_2" amino acids 8 to 39 (32 residues), 26.5 bits, see alignment 4.2e-09 amino acids 42 to 71 (30 residues), 27.8 bits, see alignment (E = 1.6e-09) PF13424: TPR_12" amino acids 9 to 69 (61 residues), 36.7 bits, see alignment E=3.7e-12 PF13414: TPR_11" amino acids 16 to 53 (38 residues), 26.9 bits, see alignment 2.8e-09 PF13181: TPR_8" amino acids 19 to 39 (21 residues), 13.8 bits, see alignment (E = 4.9e-05) amino acids 42 to 70 (29 residues), 26.5 bits, see alignment (E = 4.4e-09) amino acids 109 to 139 (31 residues), 13.1 bits, see alignment 8.4e-05 amino acids 174 to 206 (33 residues), 14.9 bits, see alignment 2.3e-05 amino acids 242 to 272 (31 residues), 14.5 bits, see alignment 2.9e-05 PF13432: TPR_16" amino acids 19 to 68 (50 residues), 33.1 bits, see alignment 5.6e-11 amino acids 86 to 138 (53 residues), 35 bits, see alignment 1.4e-11 amino acids 187 to 225 (39 residues), 19.9 bits, see alignment 7.3e-07 amino acids 213 to 273 (61 residues), 28.3 bits, see alignment E=1.8e-09 PF13374: TPR_10" amino acids 42 to 69 (28 residues), 22.7 bits, see alignment (E = 6.9e-08) PF00515: TPR_1" amino acids 43 to 70 (28 residues), 30.5 bits, see alignment (E = 2.1e-10) PF13176: TPR_7" amino acids 43 to 70 (28 residues), 17.1 bits, see alignment (E = 4.2e-06) PF07721: TPR_4" amino acids 74 to 93 (20 residues), 10 bits, see alignment (E = 0.0011) PF13174: TPR_6" amino acids 79 to 105 (27 residues), 15.3 bits, see alignment (E = 2.4e-05) PF14559: TPR_19" amino acids 85 to 146 (62 residues), 29.5 bits, see alignment E=6.7e-10 amino acids 189 to 243 (55 residues), 28.6 bits, see alignment E=1.4e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3A8 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Echvi_3582 Tetratricopeptide repeat. (Echinicola vietnamensis KMM 6221, DSM 17526)
METKRAIELNNQGARHFLNGEFEQAVSCYEEAYKLYPENTSLLNNMGLYYHQQKDFEKAV
AYFEQAIALEDKASYRINAGNAMAMQGKLDEARKQYQATAKKFPKAVGAWLSLARLATHQ
NRLEDAKAYWNEVVQLAPKPDHYLQLAKVMILQKDMEPALELLYAIVTKSENPETWFHIG
RCEFHLRNHGLAENALKKALASSPDHAEFRYYLAINHLAKGDTQEGLAQLDILLKYDSEN
PEILTEKGVILSSIHRYEEALSLFDKALKIKPGFSKAQHYKNLVENQTS