Protein Info for Echvi_3576 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Subtilisin-like serine proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00082: Peptidase_S8" amino acids 174 to 448 (275 residues), 111.4 bits, see alignment E=5.3e-36 PF18962: Por_Secre_tail" amino acids 474 to 549 (76 residues), 35.3 bits, see alignment E=1.2e-12 TIGR04183: Por secretion system C-terminal sorting domain" amino acids 474 to 550 (77 residues), 35.1 bits, see alignment E=5.1e-13

Best Hits

Predicted SEED Role

"Subtilisin-like serine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2M3 at UniProt or InterPro

Protein Sequence (550 amino acids)

>Echvi_3576 Subtilisin-like serine proteases (Echinicola vietnamensis KMM 6221, DSM 17526)
MDNIRKFIAAAGLIILSAAAVKGQDRYAVHYKYKPQETYQLDAPSAFLSQKAITRREHHE
VVVDSTDLPVSQKYIDAVKDIVINVQYNSKWMNASIVVATDEQIAAIKKLPFIEEDGIEL
IAKGFYTDDSEQRSNILSQPISIRLLSKTKDEEDYAFQNNLIGIPDMHAEQLTGKGVTIA
VFDGGFLNADKIAGMKHLFDNNQIIATRDFVMPWSAGVFRSETHGTAALSLIASNDPSTL
VAGAYDANYVLCITEDVASEYRIEEYNWVRAAEFADSLGVDIISSSLGYVTFNESSMNYS
KSDLDGKTAIITQGAVMASDRGILVVNSAGNEGSGSATTISAPADAAGILSVGAVSKDLT
KASFSSVGPTADGRIKPDVVALGRQVRLWQSPNATSTASGTSFSAPQITALAAGLWQGRP
EWTKDQLIHYILQSGSQFKDPDSQLGYGIPDFELAYYGEILDVVARPEVANTKIYPNPTD
GKELFIQFGSEEACEFTLINKNGQVINQDKLERVSNDVPYEVEISKINSGFYIVQLMEGL
NIERHKIIIQ