Protein Info for Echvi_3551 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tetrahydrodipicolinate N-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF14805: THDPS_N_2" amino acids 2 to 65 (64 residues), 88.1 bits, see alignment E=5.5e-29 PF14602: Hexapep_2" amino acids 165 to 200 (36 residues), 43.2 bits, see alignment 3.8e-15 PF00132: Hexapep" amino acids 166 to 199 (34 residues), 31 bits, see alignment 2.2e-11

Best Hits

Swiss-Prot: 54% identical to DAPD_NEIMB: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 79% identity to mtt:Ftrac_0688)

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2J8 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Echvi_3551 Tetrahydrodipicolinate N-succinyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MELKTIIENAWENRELLKEKDVEIAVKTVIEDLDKGNIRVAEPLEDGEWQVNDWVKKAVI
LYFPIQKMRTIEVGPFEFHDKMGLKTDYAKQGVRVVPHAVARYGAFLAKGVVMMPSYVNI
GAYVDSGTMVDTWATVGSCAQIGKDVHLSGGVGIGGVLEPVQAAPVIIEDGAFVGSRAII
VEGVRVGKEAVIGAGVTLTASSKIIDVTGDEPKEYRGYVPPRSVVIPGSITKKFAAGEYQ
VPCALIIGQRKASTDRKTSLNEALRDNNVAV