Protein Info for Echvi_3542 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dipeptidyl peptidase IV (DPP IV) N-terminal region./Prolyl oligopeptidase family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00930: DPPIV_N" amino acids 144 to 452 (309 residues), 188.6 bits, see alignment E=2.2e-59 PF02129: Peptidase_S15" amino acids 541 to 647 (107 residues), 24.9 bits, see alignment E=2.4e-09 PF00326: Peptidase_S9" amino acids 542 to 722 (181 residues), 156.1 bits, see alignment E=1.4e-49

Best Hits

KEGG orthology group: None (inferred from 57% identity to lby:Lbys_0215)

Predicted SEED Role

"Dipeptidyl peptidase IV in 4-hydroxyproline catabolic gene cluster" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G375 at UniProt or InterPro

Protein Sequence (748 amino acids)

>Echvi_3542 Dipeptidyl peptidase IV (DPP IV) N-terminal region./Prolyl oligopeptidase family. (Echinicola vietnamensis KMM 6221, DSM 17526)
MRKTLLVALMVGLSFKGFAQGTLIDYQRADSIKKAFEQVYHAPSRFEWIEDTNMLWYQMK
TERGQEFIQAHVDNQQKQPLFDQELIAEKLSNVLQDTIKAYELPIRNLSFKSVGSVMTFL
AEGYHWEYDLSSETLAKKEPIKDNGNRYWGTRWDDRKGDPVLAPDSSRQAFIREHNVWIK
HLSSGKTEQLTFDGAPGLYYAAHLQWSPDGEKLGAVKVRPVEVRQLTLISSSPEDQLQPK
LETRDYPKPGDALPQKTPVLLNLTSGQQFEVDQALIHDQFGISGLNWREDSRAFTFEYNQ
RGHQVYRVLALDATDGNTAVVIEETSDTFIDYSGKKFRKDLNDGQEIIWASERDGWRHLY
LFDGQTGEIKRQLTKGAWVVREVLDVDEESRMVYFLASGRSKDEDPYHLHLCKVSLDGGS
VTQLTTENANHDITLAADKEYFVDNYSRQDLAPVSVVKSLSTGKTIMELEKAVIHKIEAA
GWQAPEIFSAKGRDGETDIWGLIIKPTNFDPQKSYPILEYIYAGPHSSFVPKSFGPNYRG
LQEMAELGFIVVQVDGMGTSNRSKAFHDVCWKNLKDAGFPDRIRWIQAAAQTRPYMDVDK
VGIFGTSAGGQSSTGALLFHPEFYKVGVSSCGCHDNRMDKIWWNEQWMGYPIGKHYEACS
NVANAHRLEGKLMLIVGEVDDNVDPSSTYQLVDQLIKNNKEFEFLMVPGMGHSSGGEYGE
HKRRDFFVKNLLGVDPPAWTAFDKSIRD