Protein Info for Echvi_3492 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Phosphate/sulphate permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 129 to 156 (28 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details PF01384: PHO4" amino acids 22 to 331 (310 residues), 129.8 bits, see alignment E=6.7e-42

Best Hits

Predicted SEED Role

"Sulfate permease, Pit-type"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G326 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Echvi_3492 Phosphate/sulphate permeases (Echinicola vietnamensis KMM 6221, DSM 17526)
MSELFNSLTIPFLLAMFLAVNMGGSGTAPAFSAAYGASVIRRSLIPGLFGIMVLAGALLA
GKEVSLTLGKGLLDAAFFTPEATSLILLSISLSLLIANLLGVPQSTSQSTVLAIAGAASA
MEVFDSHKLFYVILPTWLILPVVAFGLMLVLSKWVLPMAQKKIFTSDYKQLSTHPLLKGL
LIFSSLYVAFSIGANNVANAAAPIASLTANEIGKEAIENFLPIIILSVLIVAPCFAIGSS
LMGHKVTKATGKGIVEPTPFHATVIALIVASLLMYASIMQGIPTSLVQLNGAAFIALSIS
KDGAKTTFQKPTVRKFFLVWAVAPVFAFLVAYVLTLVFLV