Protein Info for Echvi_3483 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: tRNA (guanine-N(7)-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 37 to 216 (180 residues), 121.8 bits, see alignment E=1.1e-39 PF02390: Methyltransf_4" amino acids 42 to 212 (171 residues), 106.1 bits, see alignment E=2.2e-34 PF13847: Methyltransf_31" amino acids 43 to 108 (66 residues), 35 bits, see alignment E=1.8e-12 PF13649: Methyltransf_25" amino acids 45 to 108 (64 residues), 28.8 bits, see alignment E=2.6e-10

Best Hits

Swiss-Prot: 49% identical to TRMB_CYTH3: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 52% identity to mtt:Ftrac_0331)

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0I0 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Echvi_3483 tRNA (guanine-N(7)-)-methyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MGRNKLARFKANEENRNVVQEGKEIFERIKGNWRKEQFKNERSIVVELACGRGEFTVGLA
REYPDQNFIGVDIKGSRIWKGSTIAIEEGLENVAFLRTQIEQLERFFEEKEISELWITFP
DPRPRDGDEKKRLTSPRFLEMYKPLIQEDGWIHFKTDNTGLFAYTLALLQEREDIKDLAF
THDFYASTFRDDHHGIKTRYEAMFSAKGEKIKYLKFRFR