Protein Info for Echvi_3470 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA-3-methyladenine glycosylase (3mg)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR00567: DNA-3-methyladenine glycosylase" amino acids 13 to 202 (190 residues), 209.6 bits, see alignment E=1.6e-66 PF02245: Pur_DNA_glyco" amino acids 14 to 199 (186 residues), 217.8 bits, see alignment E=3.7e-69

Best Hits

Swiss-Prot: 44% identical to 3MGH_CLOBB: Putative 3-methyladenine DNA glycosylase (CLL_A0132) from Clostridium botulinum (strain Eklund 17B / Type B)

KEGG orthology group: K03652, DNA-3-methyladenine glycosylase [EC: 3.2.2.21] (inferred from 47% identity to mpd:MCP_0033)

Predicted SEED Role

"DNA-3-methyladenine glycosylase II (EC 3.2.2.21)" in subsystem DNA Repair Base Excision (EC 3.2.2.21)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3V8 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Echvi_3470 DNA-3-methyladenine glycosylase (3mg) (Echinicola vietnamensis KMM 6221, DSM 17526)
MIENDVEILPKAFFLNKDVTEIARHLLGKIIVTYINGEYTSARIVETEAYDGTVDKACHA
FPNKITRRTAVMFSEGGRSYVYLCYGIHHLFNIVTQEEGIPKAVLIRAVEPLAGKEIMKR
RRNCHHDRQLTNGPGKAAQALGISTLHNDVILYQKNGMIYIGCEMNNLKFEINVSTRIGV
DYAGEDAKLPWRFYIKNNPNVSKQ