Protein Info for Echvi_3454 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02540: NAD_synthase" amino acids 4 to 81 (78 residues), 34.6 bits, see alignment E=2.8e-12 PF03054: tRNA_Me_trans" amino acids 5 to 207 (203 residues), 268 bits, see alignment E=1.3e-83 PF02568: ThiI" amino acids 5 to 40 (36 residues), 21.9 bits, see alignment 2.9e-08 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 5 to 228 (224 residues), 273.3 bits, see alignment E=1.3e-85 PF20259: tRNA_Me_trans_M" amino acids 265 to 310 (46 residues), 49.4 bits, see alignment 6.6e-17 PF20258: tRNA_Me_trans_C" amino acids 329 to 402 (74 residues), 53.3 bits, see alignment E=7.1e-18

Best Hits

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4B8 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Echvi_3454 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNQKKRVVVGLSGGVDSSVAAYLLQEQGYEVIGMFMKNWHDESVTISNECPWMEDSTDAM
LVAEKLGIPFQAIDLSEEYRERIVDYMFAEYKAGRTPNPDVLCNREIKFDIFLKAAKKLK
ADFVATGHYCQKGETQVEGKTVYQLLAGADLNKDQSYFLCQLNQDQLAKAQFPIGHLQKS
EVRKIAKEQDLVTADKKDSQGLCFIGKVRLPDFLQQQLKPKKGDIIIIPEDLSIYQQQQI
PAGMEADDLDEETLDQICLPVQHQAQQGKKVAEHNGAHYFTVGQRKGLNVGGTGKPLFVI
ETNTKENIIFTGLGEDHPGLLRNGLFVPAEDVHWIRDDLRLTPGQSKRYMARIRYRQPLS
GATLVMKANGLYVLFDKPQKGIAAGQFVAWYEGDESIGSGVIA