Protein Info for Echvi_3427 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribosomal protein L35

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 64 PF01632: Ribosomal_L35p" amino acids 2 to 62 (61 residues), 90.6 bits, see alignment E=3.6e-30 TIGR00001: ribosomal protein bL35" amino acids 2 to 63 (62 residues), 88.7 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 67% identical to RL35_FLAPJ: 50S ribosomal protein L35 (rpmI) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K02916, large subunit ribosomal protein L35 (inferred from 81% identity to mtt:Ftrac_0508)

MetaCyc: 53% identical to 50S ribosomal subunit protein L35 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L35p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G291 at UniProt or InterPro

Protein Sequence (64 amino acids)

>Echvi_3427 ribosomal protein L35 (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKVKTKSSAKKRFKLSGSGKIRRKHAYKSHILTKKATKRKRNLTKMGEVHESDVNRVKD
MLRI