Protein Info for Echvi_3419 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fucose permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 356 (346 residues), 105.2 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: None (inferred from 70% identity to dfe:Dfer_4329)

Predicted SEED Role

"Hypothetical sugar permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0D4 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Echvi_3419 Fucose permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MNRNLPIVLLILLIFFVISFLTNILGPIIPDIIESFDLSLGLAGFLPFSFFVAYGVMSIP
SGLLAEKYHEKKVLIVAFMIAFGGALLFAVFTSFIVALLSLFIIGIGMAMLQVVINPLLR
TAGGESHFAFNSVLGQLAFGAASFLSPMLYSHLVTHMHTDASASSLIKFLNPLVPEQLAW
VSLYWVFAAIALVMVLILVFVRFPKVTLGDDEKINIRGAFKDLIANRRVHLYFLGIFCYV
GTEQGIANWISKFLQTYHGLDPAIEGAQTISYFWGLLTIGCLLGLLLLKLMDSKKVLRIF
TGGAILALLLSLFGPTEVALITFPLTGFFASVMWSVIVSLALNSVPRHHGTFSGLLCTGI
VGGAVVPLIIGALADVAGLRWAMLFLLVTLGYVLSIGFWAKPLVKNATITSLNDLFKRQS