Protein Info for Echvi_3378 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Rhodanese-related sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 67% identity to dfe:Dfer_2923)

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2R9 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Echvi_3378 Rhodanese-related sulfurtransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MEDITVEELKERLDNKEEFPFVDVREEWEYEEDNLGALNIPLGQLAASLDELEEYKDQEL
VVHCRSGARSANAKKFLETKGYTKVRNVLGGIMAYRELEEE