Protein Info for Echvi_3377 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF05163: DinB" amino acids 69 to 145 (77 residues), 29.9 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 38% identity to rbi:RB2501_05735)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>Echvi_3377 Uncharacterized protein conserved in bacteria (Echinicola vietnamensis KMM 6221, DSM 17526)
METSVFFKELFDYGFTQNQRIILALHKHPKMASERSHLLMSHIINAHHIXNAKIMQSTPL
MKPWDVHSLEKVNSLDKENLENSLAILSNMEVDQKVSYQLRGNQVFNHPVRDLLFQVINH
TTYHRGQIAMEFRKCGLEPIMSEYIMHKMAGK