Protein Info for Echvi_3359 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: acetyl-CoA carboxylase, carboxyl transferase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 187 to 207 (21 residues), see Phobius details TIGR00513: acetyl-CoA carboxylase, carboxyl transferase, alpha subunit" amino acids 2 to 313 (312 residues), 449.5 bits, see alignment E=3.8e-139 PF03255: ACCA" amino acids 3 to 145 (143 residues), 215.3 bits, see alignment E=3.1e-68 PF01039: Carboxyl_trans" amino acids 93 to 242 (150 residues), 49.1 bits, see alignment E=3.6e-17

Best Hits

Swiss-Prot: 63% identical to ACCA_GRAFK: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA) from Gramella forsetii (strain KT0803)

KEGG orthology group: K01962, acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC: 6.4.1.2] (inferred from 78% identity to mtt:Ftrac_0182)

MetaCyc: 51% identical to acetyl-CoA carboxyltransferase subunit alpha (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G434 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Echvi_3359 acetyl-CoA carboxylase, carboxyl transferase, alpha subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MVLEFEKPIADLELKLQEMKELAKGKQIDLSADIESLEEKIQTLKKETFQNLTRWQRVQL
SRHADRPYSLDYIYEITNDFVELHGDRTVKDDKAMIGGLGDVDGRSVMFIGQQKGRNTKQ
RQERNFGMANPEGYRKALRLMKMAEKFGKPVVTLIDTPGAFPGLEAEERGQGEAIARNIR
DMFMLKVPVICIIIGEGASGGALGIAIGDRVMMLENSWYSVISPENCSTILWRSWDYKEQ
AAEALKLTASDMLGNKLVDDIIPEPLGGAHKDMKGMAVNLKAAIKKALDELDKIKPEKRI
EDRINKFSAMGVVKE