Protein Info for Echvi_3350 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted SAM-dependent methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 7 to 69 (63 residues), 69.9 bits, E=4.5e-23
• PF10672: Methyltrans_SAM
  • amino acids 106 to 356 (251 residues), 80.4 bits, E=4.7e-26
• PF02475: Met_10
  • amino acids 135 to 304 (170 residues), 44.8 bits, E=4.6e-15
• PF03602: Cons_hypoth95
  • amino acids 215 to 323 (109 residues), 38.8 bits, E=2.9e-13
• PF06325: PrmA
  • amino acids 219 to 295 (77 residues), 30.7 bits, E=7.9e-11
• PF13847: Methyltransf_31
  • amino acids 220 to 348 (129 residues), 30.3 bits, E=1.2e-10
• PF05175: MTS
  • amino acids 221 to 339 (119 residues), 35.4 bits, E=3.1e-12

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 60% identity to hhy:Halhy_0107)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See L0G2Q1 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Echvi_3350 Predicted SAM-dependent methyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTYPQITLKKGKEISLKRRHHWVFSGAIAHTAPDLKNGQLVSVFSHRQEFLGTGHYQKG
SITVRIISFEPKEINAAFWEEKLQNAYEMRAKIGLADNPATNVYRLVHGEGDQLPGLIID
HYHGTAVLQTHSVGMYQHREEISTALQTVYGEKLKAVYDKSAETLKGLAGIENQFLYGAP
LTNVVLENGCKYEIDWEKGQKTGFFIDQRENRKLLGTYSQGKKVLNTFCYSGGFSIAALE
AGAAEVHSVDISAKAIELTEKNLQLNRQFDGKHASKVADVVKYIREIEQDYDVIVLDPPA
FAKNMKARHNAVQAYKRLNAEALKHIKPGGILFTFSCSQVVDKQLFAHTITAAAIEVGRS
VRILQQLTQPADHPINAFHTETEYLKGLVLYVE