Protein Info for Echvi_3350 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted SAM-dependent methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF17785: PUA_3" amino acids 7 to 69 (63 residues), 69.9 bits, see alignment E=4.5e-23 PF10672: Methyltrans_SAM" amino acids 106 to 356 (251 residues), 80.4 bits, see alignment E=4.7e-26 PF02475: Met_10" amino acids 135 to 304 (170 residues), 44.8 bits, see alignment E=4.6e-15 PF03602: Cons_hypoth95" amino acids 215 to 323 (109 residues), 38.8 bits, see alignment E=2.9e-13 PF06325: PrmA" amino acids 219 to 295 (77 residues), 30.7 bits, see alignment E=7.9e-11 PF13847: Methyltransf_31" amino acids 220 to 348 (129 residues), 30.3 bits, see alignment E=1.2e-10 PF05175: MTS" amino acids 221 to 339 (119 residues), 35.4 bits, see alignment E=3.1e-12

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 60% identity to hhy:Halhy_0107)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2Q1 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Echvi_3350 Predicted SAM-dependent methyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTYPQITLKKGKEISLKRRHHWVFSGAIAHTAPDLKNGQLVSVFSHRQEFLGTGHYQKG
SITVRIISFEPKEINAAFWEEKLQNAYEMRAKIGLADNPATNVYRLVHGEGDQLPGLIID
HYHGTAVLQTHSVGMYQHREEISTALQTVYGEKLKAVYDKSAETLKGLAGIENQFLYGAP
LTNVVLENGCKYEIDWEKGQKTGFFIDQRENRKLLGTYSQGKKVLNTFCYSGGFSIAALE
AGAAEVHSVDISAKAIELTEKNLQLNRQFDGKHASKVADVVKYIREIEQDYDVIVLDPPA
FAKNMKARHNAVQAYKRLNAEALKHIKPGGILFTFSCSQVVDKQLFAHTITAAAIEVGRS
VRILQQLTQPADHPINAFHTETEYLKGLVLYVE