Protein Info for Echvi_3349 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Formate/nitrite family of transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 63 to 88 (26 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 43 to 285 (243 residues), 179.7 bits, see alignment E=3.2e-57

Best Hits

KEGG orthology group: None (inferred from 68% identity to zpr:ZPR_2292)

Predicted SEED Role

"Formate/nitrite transporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G227 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Echvi_3349 Formate/nitrite family of transporters (Echinicola vietnamensis KMM 6221, DSM 17526)
MADKQDKEEAKRQREEEKRQKSIDSELKKSKSVSNDGTKSHGEILKQQITEGLETYDKKA
SSLLLSSLTAGLEIGFSYLLICTVYAYFSKSLSEDISYKLTALVYPVGFIMVILGQSILF
TEQTSLLTLPVLNKKRSVGSLLKIWGLVISGNLIGGFLIAMLLLWIGPRLGIFDMQIVGK
VALHAVDFPSLVIFTSAVLAGWLMGLLSWLLSSSRDTLSKIVIIFIITSMMAFTGLHHSI
VGNVEVFAGLIGSPEITFERYLNFQVFALLGNAVGGAVFVALLKYRAFVYNIDVK