Protein Info for Echvi_3342 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: peroxiredoxin, Ohr subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR03561: peroxiredoxin, Ohr subfamily" amino acids 4 to 136 (133 residues), 166.2 bits, see alignment E=2.4e-53 PF02566: OsmC" amino acids 41 to 134 (94 residues), 64 bits, see alignment E=7.7e-22

Best Hits

Swiss-Prot: 44% identical to OHRB_BACSU: Organic hydroperoxide resistance protein OhrB (ohrB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 56% identity to rpf:Rpic12D_3667)

Predicted SEED Role

"Organic hydroperoxide resistance protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G420 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Echvi_3342 peroxiredoxin, Ohr subfamily (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTIFETRATAVGGRNGHVKSEDGILDFDVKVPTGMGGKGGEFTNPEQLFAAGYSACFDN
AVIHVASMKKAKIQSQTTATVGLAMTDDKRYELTVSLEVSIKGADQATAEDIVNTAHATC
PYSNAVKGNVNVAITVKAEA