Protein Info for Echvi_3310 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted Fe-S-cluster oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF03692: CxxCxxCC" amino acids 48 to 130 (83 residues), 51.8 bits, see alignment E=5.5e-18

Best Hits

KEGG orthology group: K06940, (no description) (inferred from 55% identity to wvi:Weevi_0785)

Predicted SEED Role

"FIG00650678: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2L6 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Echvi_3310 Predicted Fe-S-cluster oxidoreductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MDLEHFKQKSLSEYNHHKKLRARLRKIKPKLLDERFAAAHEEQFERIDCLDCANCCKTTS
PIFLQIDIDRLAKKLRMKSSEFIDAYLHRDEEGDFVLNSAPCPFLGDDNKCFVYESRPKA
CREYPHTNRKNMHGILGLTLKNTLVCPAVHEIFQVFSKEFRK