Protein Info for Echvi_3307 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: Predicted transcriptional regulators
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to Y272_METJA: Uncharacterized HTH-type transcriptional regulator MJ0272 (MJ0272) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K07729, putative transcriptional regulator (inferred from 64% identity to zpr:ZPR_3059)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0G3Z0 at UniProt or InterPro
Protein Sequence (68 amino acids)
>Echvi_3307 Predicted transcriptional regulators (Echinicola vietnamensis KMM 6221, DSM 17526) MKNSIKVERAKKNITQAELAKLAKVSRQTINAMELGKYVPSTVLALRLAQIFEVEISEIF TLEDSDWA