Protein Info for Echvi_3291 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details PF04020: Phage_holin_4_2" amino acids 10 to 113 (104 residues), 105.2 bits, see alignment E=1.4e-34

Best Hits

Swiss-Prot: 38% identical to YVLD_BACSU: Uncharacterized membrane protein YvlD (yvlD) from Bacillus subtilis (strain 168)

KEGG orthology group: K08972, putative membrane protein (inferred from 53% identity to mtt:Ftrac_0748)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3X6 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Echvi_3291 Predicted membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSGNRNSWGNVLVQLVVGGLGVIITGYLLPGVYVEDFWIGIVIAAVISLLNYTIKPILII
LTIPITIVTLGLFLLVINALIILFAAEIIPGFVVDGFWWALLFSFILSIINAIFGVSLFD
NEK