Protein Info for Echvi_3279 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details amino acids 414 to 436 (23 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 447 (435 residues), 495.9 bits, see alignment E=4.8e-153 PF01235: Na_Ala_symp" amino acids 51 to 459 (409 residues), 543.5 bits, see alignment E=2e-167

Best Hits

Swiss-Prot: 64% identical to YRBD_BACSU: Putative sodium/proton-dependent alanine carrier protein YrbD (yrbD) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 70% identity to shg:Sph21_0204)

Predicted SEED Role

"sodium/alanine symporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2I0 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Echvi_3279 amino acid carrier protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MKEIVEVVNNLVWSNALIGLCLAAGVYFSIRTRFLQVTYLKEMFRLLFRGESSEKGVSSF
QAFAIAISGRVGTGNIAGVAMAIAMGGPGAIFWMWVIAFLGGASAFVESTLGQVYKEVNE
GQYRGGPAYYIEKGLGVKWYAMLFAFATIISMTLLMPGVQSNSIALSVQNAFGVPVEYTG
MVITFFLGLIIIGGVKRISKVAEVVVPFMAAAYILMAMVIIGSNITEVPAVLTLIVKSAF
NLEAAFSGVFGMAIAWGVKRGIYSNEAGQGTAPHAAAAAEVSHPAKQGLVQAFSVYVDTL
FVCTATALMILFTGQFNVVNPEGGFIKENLPGVEVGPEYTQYAVATHFPDLGSGFVAISL
LFFAFTTIMAYYYIAETNLSYLNRFKHRAWSLWALRVMILAATFYGTIKTAKVAWMLGDI
GVGLMAWLNVIAIVLLRKPAMKTFNDYRKQLKAGKDPVFKAKEAGVDNADFWK