Protein Info for Echvi_3277 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 154 to 179 (26 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details PF18075: FtsX_ECD" amino acids 35 to 135 (101 residues), 55.1 bits, see alignment E=9.9e-19 PF02687: FtsX" amino acids 158 to 275 (118 residues), 34.8 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 49% identity to mtt:Ftrac_0776)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3F2 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Echvi_3277 Cell division protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSVLFSTTLSLFIVGLFGVIVIQAKTLTSIIRENIEVQVFLHKNISEADQAKLGKLLESQ
PYILKKEDGAQLSFITADEAAATFLADTGEDFSKFLDDNPLRDSYVLSINEEYQTSEKME
KIVAGIQKMDGVFEVTYMNDLVESINKNLMKVSIVLGAFILILVVTVIILINNTIRLALF
SQRFLIRSMQLVGATRGFIRKPFLNRSFMFGALAGIISSAMLYGLIEYTKANIDGFALLQ
NNQMQLMLFGGLVLLGAILSFFSTLRAVNKYLRMSLDELY