Protein Info for Echvi_3275 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized bacitracin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 212 to 237 (26 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details PF02673: BacA" amino acids 6 to 257 (252 residues), 243.3 bits, see alignment E=1.7e-76

Best Hits

Swiss-Prot: 54% identical to UPPP_PARD8: Undecaprenyl-diphosphatase (uppP) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 65% identity to mtt:Ftrac_0779)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G018 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Echvi_3275 Uncharacterized bacitracin resistance protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MTIIEAIILGIIQGLTEFLPVSSSGHIELGSFLLDVQAADNLLFTVVVHAATALSTIVVF
RKDLANIIKDLFKFQWNDGTQFTAKILLSMIPIGIVGVLFEEQIEMLFGGKIIFVGAMLL
VTAALLAFSHFASKREGHVTFPKALVIGVAQTIAIMPGISRSGSTIATALLIGVEKERAT
RFSFLMVLLPILGASGIKMLKYLEDPSLAEGISMTVLSAGFIAAFIAGLAACIWMINIVK
RGKLIYFAVYCAIVGLIALIGGLTM