Protein Info for Echvi_3274 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: tRNA pseudouridine 55 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 8 to 213 (206 residues), 213.8 bits, see alignment E=1.2e-67 PF01509: TruB_N" amino acids 27 to 175 (149 residues), 177.1 bits, see alignment E=3e-56 PF16198: TruB_C_2" amino acids 176 to 216 (41 residues), 33.2 bits, see alignment 4.5e-12

Best Hits

Swiss-Prot: 51% identical to TRUB_FLAJ1: tRNA pseudouridine synthase B (truB) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 59% identity to psn:Pedsa_0244)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2H6 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Echvi_3274 tRNA pseudouridine 55 synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
METPYGEVFLVNKPYRWTSFDVVKKIRNTLKIKKVGHAGTLDPLATGLLIICAGKKTKSI
NDYMGQEKEYTGTFVLGKTTASFDLEQEVEVVADPSHLTLEAIQEACKSLTGDIMQVPPT
HSAIKKDGKRVYESARKGIDVKLDPRPVTVFVFEITRCELPEIDFRIVCSKGTYIRSLAR
DLGEALQVGAYMSALTRTRIGDSHLSDASEIDEIVEKIKGEAHS