Protein Info for Echvi_3273 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: riboflavin kinase/FMN adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF06574: FAD_syn" amino acids 14 to 166 (153 residues), 166.7 bits, see alignment E=5.7e-53 TIGR00125: cytidyltransferase-like domain" amino acids 17 to 74 (58 residues), 29.9 bits, see alignment E=5e-11 TIGR00083: riboflavin biosynthesis protein RibF" amino acids 19 to 307 (289 residues), 269.5 bits, see alignment E=3.8e-84 PF01467: CTP_transf_like" amino acids 19 to 170 (152 residues), 31.1 bits, see alignment E=3.7e-11 PF01687: Flavokinase" amino acids 184 to 307 (124 residues), 147.8 bits, see alignment E=2.8e-47

Best Hits

KEGG orthology group: K11753, riboflavin kinase / FMN adenylyltransferase [EC: 2.7.1.26 2.7.7.2] (inferred from 56% identity to sli:Slin_0790)

Predicted SEED Role

"Riboflavin kinase (EC 2.7.1.26) / FMN adenylyltransferase (EC 2.7.7.2)" in subsystem Riboflavin, FMN and FAD metabolism (EC 2.7.1.26, EC 2.7.7.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.26 or 2.7.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1W3 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Echvi_3273 riboflavin kinase/FMN adenylyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKIYEGLDHFKPVKNAVVTSGTFDGVHLGHQKILDRIDNMAERMRGETVLITFWPHPRLV
LYPEEHNLRLLTTFEEKARLLEMFGIDHLITIPFTKEFSQMTSEEFIQQVLIEKIQTEKL
VIGYDHRFGKNREGSFEHLMENKARYGFDIEEISREDIDNVGISSTKIRTALLEGNVTEA
NEFLGREYELNGIVIKGQQIGRSIDFPTANIHVPNNYKLIPGDGAYAVRIGVGQEMYYGM
LNIGNRPTVDGIEQTVEAHLFDYNDNLYDKQITVYFTEFLRPERKFANLEELKAQLERDK
QKARQILGL