Protein Info for Echvi_3270 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Site-specific recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF13495: Phage_int_SAM_4" amino acids 98 to 171 (74 residues), 52.8 bits, see alignment E=6.6e-18 PF02899: Phage_int_SAM_1" amino acids 98 to 147 (50 residues), 22.3 bits, see alignment 1.9e-08 PF00589: Phage_integrase" amino acids 195 to 356 (162 residues), 153 bits, see alignment E=1.1e-48

Best Hits

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>Echvi_3270 Site-specific recombinase XerD (Echinicola vietnamensis KMM 6221, DSM 17526)
MMKNIILSNSFLGKKPMVKLEFPYDFELKELVKTFPNCEWNRHEKAWWVPYTDDILDRLI
LFFKGKVWLDYSSFRKANLPKTFPELPPLALEIFKEIEAFQDWMKNKRYSESTVMTYRGS
LEIFFRFLENKPLSEIKNEDLEKFTKDFIIDRQYSVSYQSQVINAIKLFFNIKQNRKLDP
EVVSRPRKPSKLPNVLSKEEVKRILEAHKNIKHRTMLSIIYACGLRRSEVLHLKISDVDS
KRGLLIVRQSKGKKDRVVPLSDKTIALLREYYKYERPQYFLFXGKKLNSKYSSGSLQKIL
KSALGKSGIKKPVTLHWLRHSFATHLLENGTDLRYIQEILGHNSSRTTEIYTHVTDNSIR
KIKSPFDDL