Protein Info for Echvi_3269 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized membrane protein (homolog of Drosophila rhomboid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 65 (17 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 369 to 393 (25 residues), see Phobius details amino acids 405 to 423 (19 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details amino acids 460 to 478 (19 residues), see Phobius details amino acids 484 to 502 (19 residues), see Phobius details PF01694: Rhomboid" amino acids 362 to 500 (139 residues), 93.6 bits, see alignment E=6.5e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G002 at UniProt or InterPro

Protein Sequence (516 amino acids)

>Echvi_3269 Uncharacterized membrane protein (homolog of Drosophila rhomboid) (Echinicola vietnamensis KMM 6221, DSM 17526)
MNNFGIKIKEVYLPFLVVSIGTILYYNLFRWTFDIKLGVLPLKEDLLNFWIPFALPWIPI
LIWLRRRIRVLNIRGKRDNGYFGYQFAMAAAIAVPIIVSQTYIEKASYDLVSITNAYETK
SQKDEKYFDINSFIVDKNARLPYVTARTSGRNNDNLNFYLYLACPFENSDNVWYGVEYSK
NLSNRISDDKKNREYRSFIEKSEREFETYNFQNAKYFEKLGYSDDRDGFIEAIKEKNPNI
KESEQIILVPKSDVFEERLGNTFPWIFGSFGIGASILLLMVVIPKIDEKELRDFKKDKPL
KEDDLKDMLEFLDPRGPNKATAILLLLNIAVFVIMIFAGLNIVSPTPKELLEIGGNRRFE
VVNGEYWRLFTSIFIHGGLMHLFMNLFGLGLGASLLEGILGRTQLIISFIVCGILASIAS
IYWHENTVSVGASGAIFGLYGLILAFTVFKIYPTHMRGMTWMLLGLYAGLSLLFGFLGGI
DNAAHFGGLISGFILGGILILIEKEKLIKNASKHSV