Protein Info for Echvi_3257 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details PF12833: HTH_18" amino acids 308 to 378 (71 residues), 43 bits, see alignment E=4.8e-15 PF00165: HTH_AraC" amino acids 343 to 378 (36 residues), 33.7 bits, see alignment 3e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2E1 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Echvi_3257 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MGVITIVILWAFPNKNNKSRKLLSWSFFILTSSLVYVSLIKSEFILKVPFAYSIGSVVCF
LFMPMAYLYVRGVLNKVYPSYKDIYHFIPFFLYLLNTIPYLILPLNKQISLLQENILQEG
TGELSTYALISIPTEVNLFIYHMVFGIYWLLQVWVIIAFIKHGDAEVKQENNHAINWLFF
FCSLQFLLFYPYFLDSYNPFQMSTYANFSGIGGALCVIFSAGYLFCKPEILYGFSDVLTP
IKETTVHPVKKSKMEKSGNYSSKFLSEARVIELDSKLSEHIQNNTPYLNQGYNLKDLSDD
LNVPLYIISSFINKEKGLNFNDFLNKYRIEYCKEKIRKGEWKNITLEALGYDCGFSNRNS
FTSAFKKWVGKTPSEFIKEYK