Protein Info for Echvi_3207 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Putative multicopper oxidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 51 to 158 (108 residues), 125.9 bits, see alignment E=1.4e-40 PF00394: Cu-oxidase" amino acids 166 to 319 (154 residues), 53.4 bits, see alignment E=5.1e-18 PF07731: Cu-oxidase_2" amino acids 469 to 583 (115 residues), 108.9 bits, see alignment E=2.7e-35

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 68% identity to gfo:GFO_2942)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G367 at UniProt or InterPro

Protein Sequence (780 amino acids)

>Echvi_3207 Putative multicopper oxidases (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLRFYYILTISFSLLSLSTRAQNLTEKSVEGNTDNLPVREYAISINELAVNKAGKEVMG
MAINGSVPGPTLTFTEGEYAVIYVKNEMDEETSIHWHGLLLPNFYDGVPYLTTPPIAPGE
TQKYEFPLKQAGTYWYHSHTMLQEQSGVFGSIVIHPRKENLAYDKELVIILSDWTNEKPM
NVLRFLKRGTEWYNWRKGTATPLNRVIARGAMGAQLNFWRQRMESADIADIYYPAFLVNG
EQVQEYSNFKPGEKVRLRIINGAASTSFWMTFGGEMPTLVAADGLNVEPVKRNKTFIAIA
ETYDFIVSVPESGKMEFRATAQDGSGTASAFLGQGEVLAAEDVPRPDKIGMMMQMAKMDM
RMGAPALKFNPKKDDPQKMMENWGMQMKGDKNPDNDMPGMNMAGNKEEVSQMDHSSMDMS
DDKNSKMDPPSAPMAEMPGMENMDMFSEFNYNYLKSPEKTVYGKDVPVNEILLNLTGNMN
RYIWSMNGIPLSETDKIKIKEGQITRITLNNLTMMHHPMHLHGHFFRVINESGDYSPLKH
TVNVPPMQKVTIEFYGNEYGDWFFHCHILYHMMGGMARVVSYDTPEDPRMKPFPISKLIH
ETNRFYSWGMTDVASHNTTVNLTTSNIRNQFNLSMEYGWNQNLEAEFSYEYYLYDYLRVF
GGINVENTTRNSLDDMKTIAVAGIRWFTPYMFNVDLRIDNELRPRIGIGRSLMIFPKLSI
FGYYEYQIDAGLVNGLEAGQNYKEEIVWSAGAQYMLSKNFSLMTSYDNRFGAGGGLSVMF