Protein Info for Echvi_3159 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/H+-dicarboxylate symporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details PF00375: SDF" amino acids 24 to 431 (408 residues), 394 bits, see alignment E=4e-122

Best Hits

KEGG orthology group: None (inferred from 98% identity to zpr:ZPR_3402)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>Echvi_3159 Na+/H+-dicarboxylate symporters (Echinicola vietnamensis KMM 6221, DSM 17526)
MFDTEIKSLKSLNHYLLKLVESRLWLKVIIALLLGVGFGLLLSPQNGWISKETADIAGNW
LALPGVLFLKLVQMIMIPLIVASIITGIASNDKDSLKKLGGGVLLYFLGTTIVSVSIGTI
LSQIFRPGRFLHQQALKEHNEITAVSTDEPELSFGVETIPDAISNLLPENPLASMVSGEM
LSIVIFTIIIGVAVLSLENDLLRPVKLLLSAIQEVCMTVVKWSMLLVPIAVFGLMAQLTS
SVGLSSLSGLTYYVGVVLLGLLFLVIFYLGLIVLLGKANPMHFLKKIRDVQLLAFSTTSS
AAVMPLSLQTAEEKLKVDKTISNFIIPIGATVNMDGTALYQTITTLFIAQAYGLEMSLLN
IIVVIVTIVAASIGTPAIPGGGVVILASVLGSVGIPAEGIIIIIGVERLLGMFRTAVNVM
GDLTACMVFNRLYDIKILKFLKKKLYNYG