Protein Info for Echvi_3156 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: NADH dehydrogenase, FAD-containing subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 392 to 412 (21 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 30 to 348 (319 residues), 164.4 bits, see alignment E=1.4e-51 PF00070: Pyr_redox" amino acids 183 to 268 (86 residues), 29.5 bits, see alignment E=3.1e-10 PF22366: NDH2_C" amino acids 372 to 427 (56 residues), 43.9 bits, see alignment 7.7e-15

Best Hits

KEGG orthology group: K03885, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 95% identity to zpr:ZPR_3398)

Predicted SEED Role

"NADH dehydrogenase (EC 1.6.99.3)" in subsystem Carboxysome or Respiratory dehydrogenases 1 (EC 1.6.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.3

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FZM5 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Echvi_3156 NADH dehydrogenase, FAD-containing subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MKEKQTHSITLESTCKITDEICLPDTKLPSVVIVGGGFAGLALVEKLKHKEVQVVLLDKN
NFHQFQPLLYQVATSALEPDSIVFPFRKQINGYKNVFFRLAEVVEIQPDSNTILTNKGSV
SYDYLVLATGTTTNFFGMDSVAENSLGMKDIRDSLNIRHMMLQNLEQAAITCDNKERDAL
TNFVIVGGGPAGVEMAGALAEFCKYILPKDYPEYPSSIMNIYLIEAIDELLSTMSDKASS
KTLKYLEDLNVKVLLNEAVSNYDGKEVTTISGKTILAKNLIWTAGVKGQFPNGIDEKHIV
RGNRIKTDANLKVEGYENIFAIGDIAALISEERPKGHPQVAQAAIQQGKYLGNSILNLIN
NKPTQPFEYKDKGSLATVGKRKAVADLGKFKFAGYFAWLLWSVVHLMSISGFRNRLMVGF
NWAVSYFTYEKSNRLIIRNFKPKSLIDNTEE