Protein Info for Echvi_3131 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Arginase/agmatinase/formimionoglutamate hydrolase, arginase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00491: Arginase
  • amino acids 34 to 342 (309 residues), 195.7 bits, E=5.8e-62

Best Hits

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 50% identity to npu:Npun_R6035)

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• superpathway of polyamine biosynthesis I (3/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (4/11 steps found)
• superpathway of L-arginine and L-ornithine degradation (5/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11

Sequence Analysis Tools

See L0G220 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Echvi_3131 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTKKQKAIDKFDPNGVSSEGSIFGLPFDEETASVVIVPVPWEVTVSYAPGTANGPQAIL
DASSQVDLFQDDITDAWTMGIHMLPIPENVYSNNTKYRILAGNYIDWLERGSPKEERERF
GAVPALIDKACQSMNDWVYETAKDQLNQGKLVALVGGDHSTPLGHIKALSERYSSFGILQ
IDAHADLRDQYEGFNYSHASISHNFLNIPQVEKLVQVGVRDYCEEESDRIDGDDRITTFF
DHHIKEQLYEGVTWRTICDQVIASLPREIYITIDIDGLDPKLCPHTGTPVPGGFDLNQLL
YLMKLIVKSGRKIIGFDLVEVAPGEDDSEWDGNVGARLLYRMSNLMGVSHGKLWWK