Protein Info for Echvi_3112 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type hemin transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00005: ABC_tran" amino acids 18 to 168 (151 residues), 100.1 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 41% identical to HMUV_PHOLL: Hemin import ATP-binding protein HmuV (hmuV) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 41% identity to mmt:Metme_0954)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3C3 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Echvi_3112 ABC-type hemin transport system, ATPase component (Echinicola vietnamensis KMM 6221, DSM 17526)
MMISAENIHFCIQKRPILDQVDLQIYPGEVLTILGPNGAGKSTLLKLLSGENTCDTGKIS
INQVLLQQLKPRQLAKYRAVMPQHSSVNFPYTVEEIIALGKLAHDPHSSSDQLMEEVMDI
TGTAALRERMIKGLSGGERQRVHLARALLQIWEDKPYARYLLLDEPTSSMDIAQQHQVLR
LLRFLRQRNIGVLTILHDLNLAAQYSDKVMLMKDGKVVGFGPTSAIMTATKLSHVYGHPI
SVMSHPMDEKQVVITSETTSNNHTYASFKTA